General Information

  • ID:  hor006643
  • Uniprot ID:  P56173
  • Protein name:  Putative insulin-like peptide beta-type 6
  • Gene name:  ins-5
  • Organism:  Caenorhabditis elegans
  • Family:  Insulin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0040024 dauer larval development
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  LHQKHQGFILSSSDSTGNQPMDAISRADRHTNYRSCALRLIPHVWSVCGDACQPQNGIDVAQKCCSTDCSSDYIKEICCPFD
  • Length:  82(19-100)
  • Propeptide:  MHSIVALMLIGTILPIAALHQKHQGFILSSSDSTGNQPMDAISRADRHTNYRSCALRLIPHVWSVCGDACQPQNGIDVAQKCCSTDCSSDYIKEICCPFD
  • Signal peptide:  MHSIVALMLIGTILPIAA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  36-65; 48-78; 52-79; 64-69
  • Structure ID:  AF-P56173-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006643_AF2.pdbhor006643_ESM.pdb

Physical Information

Mass: 1052017 Formula: C381H595N115O125S9
Absent amino acids: Common amino acids: S
pI: 6.48 Basic residues: 11
Polar residues: 30 Hydrophobic residues: 21
Hydrophobicity: -43.66 Boman Index: -17168
Half-Life: 5.5 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 64.27
Instability Index: 4310.49 Extinction Coefficient cystines: 8980
Absorbance 280nm: 110.86

Literature

  • PubMed ID:  9851916
  • Title:  Genome sequence of the nematode C. elegans: a platform for investigating biology.
  • PubMed ID:  9548970
  • Title:  New insulin-like proteins with atypical disulfide bond pattern characterized in Caenorhabditis elegans by comparative sequence analysis and homology modeling.